Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306536
StrainMtb_RGTB327
Protein IDYP_005359347.1
Description exonuclease V subunit alpha [Mycobacterium tuberculosis RGTB327]
Sequence MKLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALA
VAVAVRALRAGSVCVDLLSIARVAGHDDLPWPDPAAWLAAVRASPLLADP
PVLHLYDDRLLYLDRYWREEEQVCADLLALLTSRRPAGVPDLRRLFPTGF
DEQRRAAEIALSQGVTVLTGGPGTGKTTTVARLLALVAEQAELAGEPRPR
IALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVTLHRLLGAKPG
ARFRQDRQNRLPHNVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQ
LASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGTLAEAIRAGDG
DAVLGLLRSGEERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVAL
ATLDEHRLLCAHRDGPTGVLHWNRRVQAWLAEETGQPPWTPWYAGRPLLV
TANDYGLRVYNGDTGVVLAGPTGLRAVISGASGPLDVATGRLGDVETMHA
MTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVTRAKRKVRVVGSEAS
VRAAIARRAVRASGLRMRLQSTGCG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)42
MHC class II prediction (Propred)90
MHC class 1 prediction (Propred1)420
CTL epitope prediction (CTLpred)117
Prediction of interferon-gamma inducing peptides (IFNepitope)278
Prediction of IL4 inducing peptides (IL4pred)298