Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306554
StrainMtb_RGTB327
Protein IDYP_005359365.1
Description carboxyl esterase [Mycobacterium tuberculosis RGTB327]
Sequence MDIRSGTAVSGDVKLYYEDMGDLDHPPVLLIMGLGAQMLLWRTDFCARLV
AKGLRVIRYDNRDVGLSTKTERHRPGQPLATRLVRSWLGLPSQAAYTLED
MAADAAALLDHLDVKHAHVVGASMGGMIAQIFAARFAQRTKTLAVIFSSN
NHRFLPPPAPRALLALLTGPPPDSPRDVIVDNAVRVSKIIGSPAYPIPED
QVRAEAAESYDRNFHPWGIAQQFSAILGSGSLLRYDRRIVAPTVVIHGRA
DKLMRPFGGRAVARAINGARLVLIDGMGHDLPRQLWDRVIGELTRNFSEA
G
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo