Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306610
StrainMtb_RGTB327
Protein IDYP_005359421.1
Description 50S ribosomal protein L29 [Mycobacterium tuberculosis RGTB327]
Sequence MRESKEELFNLRFQMATGQLNNNRRLRTVRQEIARIYTVLRERELGLATG
PDGKES
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo