Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306678
StrainMtb_RGTB327
Protein IDYP_005359489.1
Description hypothetical protein MRGA327_04855 [Mycobacterium tuberculosis RGTB
Sequence MRSRFLPYATTPGRLLAQLISDITVAVWTTLWMLVGLAVHDAISIIGEAG
RQIEIGSHGIAGNLAAAGQDAQRIPVVGDALSNPITAASQAALDIAGAGH
NLDTTAGWLAVVLALAVAATPILAVAMPWLFLRLRFCRRKWTVTTLAATP
AGRQLLALRALANRPPGKLAAVSTDPVGAWRREDPATMRALAALELRAAG
IPLRGD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo