Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306764
StrainMtb_RGTB327
Protein IDYP_005359575.1
Description putative molybdopterin biosynthesis MOG protein [Mycobacterium tube
Sequence MSTRSARIVVVSSRAAAGVYTDDCGPIIAGWLEQHGFSSVQPQVVADGNP
VGEALHDAVNAGVDVIITSGGTGISPTDTTPEHTVAVLDYVIPGLADAIR
RSGLPKVPTSVLSRGVCGVAGRTLIINLPGSPGGVRDGLGVLADVLDHAL
EQIAGGDHPR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo