Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306766
StrainMtb_RGTB327
Protein IDYP_005359577.1
Description molybdenum cofactor biosynthesis protein D [Mycobacterium tuberculo
Sequence MTQVSDESAGIQVTVRYFAAARAAAGAGSEKVTLRSGATVAELIDGLSVR
DVRLATVLSRCSYLRDGIVVRDDAVALSAGDTIDVLPPFAGG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo