Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306768
StrainMtb_RGTB327
Protein IDYP_005359579.1
Description hypothetical protein MRGA327_05470 [Mycobacterium tuberculosis RGTB
Sequence MQPYGGNGGAGGNAQAPGGVGGAGGEGGDAQVGTNSPSNAEAGNGGSGGN
GFDSFASGGTGGAGGTGGAGGRGGLLIGDGGAGGAGGVGGTGGSGAPGGG
GGAGGDGGAANTDSAGSSRKAFGGDGGVGGDGASALGTGGEGGIGGQGGN
GGAGGLLIGNGGAGGVGGTAGAGGTGGSGGAGGAGGAGGGGTNSGPGAAF
GGNGNTGGNGGNGGAPGALGGKGGSGGLIGRAGSDGGVGAGGAGGAGGAG
GTGGEGGTGGDGKTTDGNPGMGGSPGSAGQPG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo