Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306794
StrainMtb_RGTB327
Protein IDYP_005359605.1
Description two component response transcriptional regulatory protein PRRA [Myc
Sequence MDTGVTSPRVLVVDDDSDVLASLERGLRLSGFEVATAVDGAEALRSATEN
RPDAIVLDINMPVLDGVSVVTALRAMDNDVPVCVLSARSSVDDRVAGLEA
GADDYLVKPFVLAELVARVKALLRRRGSTATSSSETITVGPLEVDIPGRR
ARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVV
DVFIGYLRRKLEAGGGPRLLHTVRGVGFVLRMQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo