Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306842
StrainMtb_RGTB327
Protein IDYP_005359653.1
Description phosphoribosylglycinamide formyltransferase [Mycobacterium tubercul
Sequence MQEPLRVPPSAPARLVVLASGTGSLLRSLLDAAVGDYPARVVAVGVDREC
RAAEIAAEASVPVFTVRLADHPSRDAWDVAITAATAAHEPDLVVSAGFMR
ILGPQFLSRFYGRTLNTHPALLPAFPGTHGVADALAYGVKVTGATVHLVD
AGTDTGPILAQQPVPVLDGDDEETLHERIKVTERRLLVAAVAALATHGVT
VVGRTATMGRKVTIG
B cell epitope (IEDB)2
T cell epitope (IEDB)2
MHC binder (IEDB)0
Vaccine TargetNo