Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306892
StrainMtb_RGTB327
Protein IDYP_005359703.1
Description resuscitation-promoting factor rpfB [Mycobacterium tuberculosis RGT
Sequence MLRLVVGALLLVLAFAGGYAVAACKTVTLTVDGTAMRVTTMKSRVIDIVE
ENGFSVDDRDDLYPAAGVQVHDADTIVLRRSRPLQISLDGHDAKQVWTTA
STVDEALAQLAMTDTAPAAASRASRVPLSGMALPVVSAKTVQLNDGGLVR
TVHLPAPNVAGLLSAAGVPLLQSDHVVPAATAPIVEGMQIQVTRNRIKKV
TERLPLPPNARRVEDPEMNMSREVVEDPGVPGTQDVTFAVAEVNGVETGR
LPVANVVVTPAHEAVVRVGTKPGTEVPPVIDGSIWDAIAGCEAGGNWAIN
TGNGYYGGVQFDQGTWEANGGLRYAPRADLATREEQIAVAEVTRLRQGWG
AWPVCAARAGAR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo