Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306896
StrainMtb_RGTB327
Protein IDYP_005359707.1
Description 50S ribosomal protein L25/general stress protein Ctc [Mycobacterium
Sequence MAKSASNQLRVTVRTETGKGASRRARRAGKIPAVLYGHGAEPQHLELPGH
DYAAVLRHSGTNAVLTLDIAGKEQLALTKALHIHPIRRTIQHADLLVVRR
GEKVVVEVSVVVEGQAGPDTLVTQETNSIEIEAEALSIPEQLTVSIEGAE
PGTQLTAGQIALPAGVSLISDPDLLVVNVVKAPTAEELEGEVAGAEEAEE
AAVEAGEAEAAGESE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo