Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306914
StrainMtb_RGTB327
Protein IDYP_005359725.1
Description DNA-binding response regulator TrcR [Mycobacterium tuberculosis RGT
Sequence MTTMSGYTRSQRPRQAILGQLPRIHRADGSPIRVLLVDDEPALTNLVKMA
LHYEGWDVEVAHDGQEAIAKFDKVGPDVLVLDIMLPDVDGLEILRRVRES
DVYTPTLFLTARDSVMDRVTGLTSGADDYMTKPFSLEELVARLRGLLRRS
SHLERPADEALRVGDLTLDGASREVTRDGTPISLSSTEFELLRFLMRNPR
RALSRTEILDRVWNYDFAGRTSIVDLYISYLRKKIDSDREPMIHTVRGIG
YMLRPPE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo