Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306950
StrainMtb_RGTB327
Protein IDYP_005359761.1
Description PE-PGRS family protein [Mycobacterium tuberculosis RGTB327]
Sequence MREMSYMIAVPDMLSSAAGDLASIGSSINASTRAAAAATTRLLPAAADEV
SAHIAALFSGHGEGYQAIARQMAAFHDQFTLALTSSAGAYASAEATNVEQ
QVLGLINAPTQALLGRPLIGNGADGTAANPNGGAGGLLYGNGGNGFSQTT
AGLTGGTGGSAGLIGNGGNGGAGGAGANGGAGGNGGWLYGSGGNGGAGGA
GPAGAIGAPGVAGGAGGAGGTAGLFGNGGAGGAGGAGGAGGRGGDGGSAG
WLSGNGGDAGTGGGGGNAGNGGNGGSAGWLSGNGGTGGGGGTAGAGGQGG
NGNSGIDPGNGGQGADTGNAGNGGHGGSAAKLFGDGGAGGAGGMGSTGGT
GGSGGFGGGTGGNGGNGHAGGAGGSGGTAGLLGSGGSGGTGGDGGNGGLG
AGSGAKGNGGNGGDGGKGGDAQLIGNGGNGGNGGKGGTGLMPGINGTGGA
GGSRGQISGNPGTPGQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo