Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306984
StrainMtb_RGTB327
Protein IDYP_005359795.1
Description glycosyl hydrolase [Mycobacterium tuberculosis RGTB327]
Sequence MPKRPDNQTWRYWRTVTGVVVAGAVLVVGGLSGRVTRAENLSCSVIKCVA
LTFDDGPGPYTDRLLHILTDNDAKATFFLIGNKVAANPAGARRIADAGME
IGSHTWEHPNMTTIPPEDIPGQFSRANDVIAAATGRTPTLYRPAGGLSND
AVRQAAAKVGQAEILWDVIPFDWINDSNTAATRHMLMTQIKPGSVVLFHD
TYSSTVDVVYQFIPVLKANGYRLVTVSELLGPRAPGSSYGSRENGPPVNE
LRDIPASEIPPLPNTSSPKPMPNFPITDIAGQNSGGPNNGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)2
Vaccine TargetYes
B cell prediction (LBtope)29
MHC class II prediction (Propred)40
MHC class 1 prediction (Propred1)185
CTL epitope prediction (CTLpred)43
Prediction of interferon-gamma inducing peptides (IFNepitope)102
Prediction of IL4 inducing peptides (IL4pred)195