Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307116
StrainMtb_RGTB327
Protein IDYP_005359927.1
Description putative magnesium and cobalt transport transmembrane protein CORA
Sequence MFPGFDALPEVLRPVARPQPPNAHPVAQPPAQALVDCGVYVCGQRLPGKY
TYAAALREVREIELTGQEAFVWIGLHEPDENQMQDVADVFGLHPLAVEDA
VHAHQRPKLERYDETLFLVLKTVNYVPHESVVLAREIVETGEIMIFVGKD
FVVTVRHGEHGGLSEVRKRMDADPEHLRLGPYAVMHAIADYVVDHYLEVT
NLMETDIDSIEEVAFAPGRKLDIEPIYLLKREVVELRRCVNPLSTAFQRM
QTESKDLISKEVRRYLRDVADHQTEAADQIASYDDMLNSLVQAALARVGM
QQNMDMRKISAWAGIIAVPTMIAGIYGMNFHFMPELDSRWGYPTVIGGMV
LICLFLYHVFRNRNWL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo