Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307132
StrainMtb_RGTB327
Protein IDYP_005359943.1
Description membrane transporter [Mycobacterium tuberculosis RGTB327]
Sequence MRNSNRGPAFLILFATLMAAAGDGVSIVAFPWLVLQREGSAGQASIVASA
TMLPLLFATLVAGTAVDYFGRRRVSMVADALSGAAVAGVPLVAWGYGGDA
VNVLVLAVLAALAAAFGPAGMTARDSMLPEAAARAGWSLDRINGAYEAIL
NLAFIVGPAIGGLMIATVGGITTMWITATAFGLSILAIAALQLEGAGKPH
HTSRPQGLVSGIAEGLRFVWNLRVLRTLGMIDLTVTALYLPMESVLFPKY
FTDHQQPVQLGWALMAIAGGGLVGALGYAVLAIRVPRRVTMSTAVLTLGL
ASMVIAFLPPLPVIMVLCAVVGLVYGPIQPIYNYVIQTRAAQHLRGRVVG
VMTSLAYAAGPLGLLLAGPLTDAAGLHATFLALALPIVCTGLVAIRLPAL
RELDLAPQADIDRPVGSAQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)4
Vaccine TargetNo