Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307156
StrainMtb_RGTB327
Protein IDYP_005359967.1
Description sulfate adenylyltransferase subunit 2 [Mycobacterium tuberculosis R
Sequence MTSDVTVGPAPGQYQLSHLRLLEAEAIHVIREVAAEFERPVLLFSGGKDS
IVMLHLALKAFRPGRLPFPVMHVDTGHNFDEVIATRDELVAAAGVRLVVA
SVQDDIDAGRVVETIPSRNPIQTVTLLRAIRENQFDAAFGGARRDEEKAR
AKERVFSFRDEFGQWDPKAQRPELWNLYNGRHHKGEHIRVFPLSNWTEFD
IWSYIGAEQVRLPSIYFAHRRKVFQRDGMLLAVHRHMQPRADEPVFEATV
RFRTVGDVTCTGCVESSASTVAEVIAETAVARLTERGATRADDRISEAGM
EDRKRQGYF
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo