Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307280
StrainMtb_RGTB327
Protein IDYP_005360091.1
Description riboflavin synthase subunit alpha [Mycobacterium tuberculosis RGTB3
Sequence MFTGIVEERGEVTGREALVDAARLTIRGPMVTADAGHGDSIAVNGVCLTV
VDVLPDGQFTADVMAETLNRSNLGELRPGSRVNLERAAALGSRLGGHIVQ
GHVDATGEIVARCPSEHWEVVRIEMPASVARYVVEKGSITVDGISLTVSG
LGAEQRDWFEVSLIPTTRELTTLGSAAVGTRVNLEVDVVAKYVERLMRSA
G
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo