Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307284
StrainMtb_RGTB327
Protein IDYP_005360095.1
Description 6-7-dimethyl-8-ribityllumazine synthase [Mycobacterium tuberculosis
Sequence MKGGAGVPDLPSLDASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDD
PTVVRVLGAIEIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQG
LTRVSLDSSTPIANGVLTTNTEEQALDRAGLPTSAEDKGAQATVAALATA
LTLRELRAHS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo