Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307288
StrainMtb_RGTB327
Protein IDYP_005360099.1
Description glmZ(sRNA)-inactivating NTPase [Mycobacterium tuberculosis RGTB327]
Sequence MMNHARGVENRSEGGGIDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPP
QLITRMVDFGLAAGSRITQLAVVMDVRSRGFTGDLDSVRNELATRAITPR
VVFMEASDDTLVRRYEQNRRSHPLQGEQTLAEGIAAERRMLAPVRATADL
IIDTSTLSVGGLRDSIERAFGGDGGATTSVTVESFGFKYGLPMDADMVMD
VRFLPNPHWVDELRPLTGQHPAVRDYVLHRPGAAEFLESYHRLLSLVVDG
YRREGKRYMTIAIGCTGGKHRSVAIAEALMGLLRSDQQLSVRALHRDLGR
E
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo