Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307370
StrainMtb_RGTB327
Protein IDYP_005360181.1
Description GDP-mannose 4-6-dehydratase [Mycobacterium tuberculosis RGTB327]
Sequence MKRALITGITGQDGSYLAELLLAKGYEVHGLIRRASTFNTSRIDHLYVDP
HQPGARLFLHYGDLIDGTRLVTLLSTIEPDEVYNLAAQSHVRVSFDEPVH
TGDTTGMGSMRLLEAVRLSRVHCRFYQASSSEMFGASPPPQNELTPFYPR
SPYGAAKVYSYWATRNYREAYGLFAVNGILFNHESPRRGETFVTRKITRA
VARIKAGIQSEVYMGNLDAVRDWGYAPEYVEGMWRMLQTDEPDDFVLATG
RGFTVREFARAAFEHAGLDWQQYVKFDQRYLRPTEVDSLIGDATKAAELL
GWRASVHTDELARIMVDADMAALECEGKPWIDKPMIAGRT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo