Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307472
StrainMtb_RGTB327
Protein IDYP_005360283.1
Description excinuclease ABC subunit B [Mycobacterium tuberculosis RGTB327]
Sequence MAFATEHPVVAHSEYRAVEEIVRAGGHFEVVSPHAPAGDQPAAIDELERR
INAGERDVVLLGATGTGKSATTAWLIERLQRPTLVMAPNKTLAAQLANEL
REMLPHNAVEYFVSYYDYYQPEAYIAQTDTYIEKDSSINDDVERLRHSAT
SALLSRRDVVVVASVSCIYGLGTPQSYLDRSVELKVGEEVPRDGLLRLLV
DVQYTRNDMSFTRGSFRVRGDTVEIIPSYEELAVRIEFFGDEIEALYYLH
PLTGEVIRQVDSLRIFPATHYVAGPERMAHAVSAIEEELAERLAELESQG
KLLEAQRLRMRTNYDIEMMRQVGFCSGIENYSRHIDGRGPGTPPATLLDY
FPEDFLLVIDESHVTVPQIGGMYEGDISRKRNLVEYGFRLPSACDNRPLT
WEEFADRIGQTVYLSATPGPYELSQTGGEFVEQVIRPTGLVDPKVVVKPT
KGQIDDLIGEIRTRADADQRVLVTTLTKKMAEDLTDYLLEMGIRVRYLHS
EVDTLRRVELLRQLRLGDYDVLVGINLLREGLDLPEVSLVAILDADKEGF
LRSSRSLIQTIGRAARNVSGEVHMYADKITDSMREAIDETERRRAKQIAY
NEANGIDPQPLRKKIADILDQVYREADDTAVVEVGGSGRNASRGRRAQGE
PGRAVSAGVFEGRDTSAMPRAELADLIKDLTAQMMAAARDLQFELAARFR
DEIADLKRELRGMDAAGLK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)7
Vaccine TargetNo