Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307476
StrainMtb_RGTB327
Protein IDYP_005360287.1
Description excinuclease ABC subunit A [Mycobacterium tuberculosis RGTB327]
Sequence MADRLIVKGAREHNLRSVDLDLPRDALIVFTGLSGSGKSSLAFDTIFAEG
QRRYVESLSAYARQFLGQMDKPDVDFIEGLSPAVSIDQKSTNRNPRSTVG
TITEVYDYLRLLYARAGTPHCPTCGERVARQTPQQIVDQVLAMPEGTRFL
VLAPVVRTRKGEFADLFDKLNAQGYSRVRVDGVVHPLTDPPKLKKQEKHD
IEVVVDRLTVKAAAKRRLTDSVETALNLADGIVVLEFVDHELGAPHREQR
FSEKLACPNGHALAVDDLEPRSFSFNSPYGACPECSGLGIRKEVDPELVV
PDPDRTLAQGAVAPWSNGHTAEYFTRMMAGLGEALGFDVDTPWRKLPAKA
RKAILEGADEQVHVRYRNRYGRTRSYYADFEGVLAFLQRKMSQTESEQMK
ERYEGFMRDVPCPVCAGTRLKPEILAVTLAGESKGEHGAKSIAEVCELSI
ADCADFLNALTLGPREQAIAGQVLKEIRSRLGFLLDVGLEYLSLSRAAAT
LSGGEAQRIRLATQIGSGLVGVLYVLDEPSIGLHQRDNRRLIETLTRLRD
LGNTLIVVEHDEDTIEHADWIVDIGPGAGEHGGRIVHSGPYDELLRNKDS
ITGAYLSGRESIEIPAIRRSVDPRRQLTVVGAREHNLRGIDVSFPLGVLT
SVTGVSGSGKSTLVNDILAAVLANRLNGARQVPGRHTRVTGLDYLDKLVR
VDQSPIGRTPRSNPATYTGVFDKIRTLFAATTEAKVRGYQPGRFSFNVKG
GRCEACTGDGTIKIEMNFLPDVYVPCEVCQGARYNRETLEVHYKGKTVSE
VLDMSIEEAAEFFEPIAGVHRYLRTLVDVGLGYVRLGQPAPTLSGGEAQR
VKLASELQKRSTGRTVYILDEPTTGLHFDDIRKLLNVINGLVDKGNTVIV
IEHNLDVIKTSDWIIDLGPEGGAGGGTVVAQGTPEDVAAVPASYTGKFLA
EVVGGGASAATSRSNRRRNVSA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)4
Vaccine TargetNo