Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307534
StrainMtb_RGTB327
Protein IDYP_005360345.1
Description D-serine/alanine/glycine transporter protein CYCA [Mycobacterium tu
Sequence MTSPPTSWARRRAFSWGGRTGSHGWSPGSQTSFAITGYARFWWPGLPIWV
PALVTVALILAVNLFSVRHFGELEFWFALIKVAAIVCLIAVGAILVATNF
VSPHGVHATIENLWNDNGFFPTGFLGVVSGFQIAFFAYIGVELVGTAAAE
TADPRRTLPRAINAVPLRVAVFYIGALLAILAVVPWRQFASGESPFVTMF
SLAGLAAAASVVNFVVVTAAASSANSGFFSTGRMLFGLADEGHAPAAFHQ
LNRGGVPAPALLLTAPLLLTSIPLLYAGRSVIGAFTLVTTVSSLLFMFVW
AMIIISYLVYRRRHPQRHTDSVYKMPGGVVMCWAVLVFFAFVIWTLTTET
ETATALAWFPLWFVLLAVGWLVTQRRQSRRSFGFHCQVVGVRQQLGRGMA
RLAMKIHARPKLRSAGRRRASVSR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo