Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307571
StrainMtb_RGTB327
Protein IDYP_005360382.1
Description Ser/Thr protein kinase [Mycobacterium tuberculosis RGTB327]
Sequence MDGTAESREGTQFGPYRLRRLVGRGGMGDVYEAEDTVRERIVALKLMSET
LSSDPVFRTRMQREARTAGRLQEPHVVPIHDFGEIDGQLYVDMRLINGVD
LAAMLRRQGPLAPPRAVAIVRQIGSALDAAHAAGATHRDVKPENILVSAD
DFAYLVDFGIASATTDEKLTQLGNTVGTLYYMAPERFSESHATYRADIYA
LTCVLYECLTGSPPYQGDQLSVMGAHINQAIPRPSTVRPGIPVAFDAVIA
RGMAKNPEDRYVTCGDLSAAAHAALATADQDRATDILRRSQVAKLPVPST
HPVSPGTRWPQPTPWAGGAPPWGPPSSPLPRSARQPWLWVGVAVAVVVAL
AGGLGIALAHPWRSSGPRTSAPPPPPPADAVELRVLNDGVFVGSSVAPTT
IDIFNEPICPPCGSFIRSYASDIDTAVADKQLAVRYHLLNFLDDQSHSKN
YSTRAVAASYCVAGQNDPKLYASFYSALFGSDFQPQENAASDRTDAELAH
LAQTVGAEPTAISCIKSGADLGTAQTKATNASETLAGFNASGTPFVWDGS
MVVNYQDPSWLARLIG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)48
MHC class II prediction (Propred)76
MHC class 1 prediction (Propred1)370
CTL epitope prediction (CTLpred)82
Prediction of interferon-gamma inducing peptides (IFNepitope)188
Prediction of IL4 inducing peptides (IL4pred)338