Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 383307637 |
| Strain | Mtb_RGTB327 |
| Protein ID | YP_005360448.1 |
| Description | hypothetical protein MRGA327_11230 [Mycobacterium tuberculosis RGTB |
| Sequence | MITNLRRRTAMAAAGLGAALGLGILLVPTVDAHLANGSMSEVMMSEIAGL PIPPIIHYGAIAYAPSGASGKAWHQRTPARAEQVALEKCGDKTCKVVSRF TRCGAVAYNGSKYQGGTGLTRRAAEDDAVNRLEGGRIVNWACN |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 1 |
| MHC binder (IEDB) | 1 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 19 |
| MHC class II prediction (Propred) | 18 |
| MHC class 1 prediction (Propred1) | 96 |
| CTL epitope prediction (CTLpred) | 21 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 75 |
| Prediction of IL4 inducing peptides (IL4pred) | 87 |