Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307650
StrainMtb_RGTB327
Protein IDYP_005360461.1
Description MerR family transcriptional regulator [Mycobacterium tuberculosis R
Sequence MSAPDSPALAGMSIGAVLDLLRPDFPDVTISKIRFLEAEGLVTPRRASSG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPPFGSPYVL
PRLVPVAGDSAGGVGSDTASVSLTGIRLSREDLLERSEVADELLTALLKA
GVITTGPGGFFDEHAVVILQCARALAEYGVEPRHLRAFRSAADRQSDLIA
QIAGPLVKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRDVLHR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo