Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307698
StrainMtb_RGTB327
Protein IDYP_005360509.1
Description bacterioferritin [Mycobacterium tuberculosis RGTB327]
Sequence MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFD
EMRHAEEITDRILLLDGLPNYQRIGSLRIGQTLREQFEADLAIEYDVLNR
LKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLELMDKLGEELYS
AQCVSRPPT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo