Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307792
StrainMtb_RGTB327
Protein IDYP_005360603.1
Description hypothetical protein MRGA327_12185 [Mycobacterium tuberculosis RGTB
Sequence MRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSDPAY
NINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATY
QSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQA
DTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFF
FNPGELLPEAAGPTQVLVPRSAIDSMLA
B cell epitope (IEDB)7
T cell epitope (IEDB)149
MHC binder (IEDB)16
Vaccine TargetNo