Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307834
StrainMtb_RGTB327
Protein IDYP_005360645.1
Description hypothetical protein MRGA327_12440 [Mycobacterium tuberculosis RGTB
Sequence MAPGMKWAAKTDHLAIVLLPRHHRRHSRRGRALPARSRSALGWIIERYRV
TTDKASGIVNDPNDWCDEHDDPTYIVDLIKKVTTVSVETMKIVDGLAGG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo