Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307845
StrainMtb_RGTB327
Protein IDYP_005360656.1
Description hypothetical protein MRGA327_12505 [Mycobacterium tuberculosis RGTB
Sequence MPDTMVTTDVIKSAVQLACRAPSLHNSQPWRWIAEDHTVALFLDKDRVLY
ATDHSGREALLGCGAVLDHFRVAMAAAGTTANVERFPNPNDPLHLASIDF
SPADFVTEGHRLRADAILLRRTDRLPFAEPPDWDLVESQLRTTVTADTVR
IDVIADDMRPELAAASKLTESLRLYDSSYHAELFWWTGAFETSEGIPHSS
LVSAAESDRVTFGRDFPVVANTDRRPEFGHDRSKVLVLSTYDNERASLLR
CGEMLSAVLLDATMAGLATCTLTHITELHASRDLVAALIGQPATPQALVR
VGLAPEMEEPPPATPRRPIDEVFHVRAKDHR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)38
MHC class II prediction (Propred)41
MHC class 1 prediction (Propred1)222
CTL epitope prediction (CTLpred)45
Prediction of interferon-gamma inducing peptides (IFNepitope)138
Prediction of IL4 inducing peptides (IL4pred)257