Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307852
StrainMtb_RGTB327
Protein IDYP_005360663.1
Description sugar ABC transporter [Mycobacterium tuberculosis RGTB327]
Sequence MTRRRGRRAWAGRMFVAPNLAAVVVFMLFPLGFSLYMSFQKWDLFTHATF
VRLDNFRNLFTSDPLFLIAVVNTAVYTVGTVVPTVIVSLVVAAFLNRKIK
GISLFRTVVFLPLAISSVVMAVVWQFVFNTDNGLLNIMLGWLGIGPIPWL
IEPRWAMVSLCLVSVWRSVPFATVVLLAAMQGVPETVYEAARIDGAGEIR
QFVSITVPLIRGALSFVVVISIIHAFQAFDLVYVLTGANGGPETATYVLG
IMLFQHAFSFLEFGYASALAWVMFAILLVLTVLQLRITHRRSWEASRGLG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo