Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307905
StrainMtb_RGTB327
Protein IDYP_005360716.1
Description hypothetical protein MRGA327_12905 [Mycobacterium tuberculosis RGTB
Sequence MSPAHFNGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGSHP
EYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNN
TDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPK
AATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGD
SNMSETTTMLKVGTAALVLEMIESGVAFRDFSLDNPIRAIREVSHDVTGR
RPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIEQVVDLWGRQLDA
VESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDIKR
GRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAG
RDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIASM
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)25
MHC class II prediction (Propred)59
MHC class 1 prediction (Propred1)311
CTL epitope prediction (CTLpred)81
Prediction of interferon-gamma inducing peptides (IFNepitope)176
Prediction of IL4 inducing peptides (IL4pred)292