Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307906
StrainMtb_RGTB327
Protein IDYP_005360717.1
Description hypothetical protein MRGA327_12910 [Mycobacterium tuberculosis RGTB
Sequence MVPAVAAGAARLARSAAVASGARATPAAAVATAGVWYGNGGAGGAAGQGG
PGMNTTSPGGPGGVGGHGGTAILFGDGGAGGAGAAGGPGTPDGAAGPGGS
GGTGGLLFGVPGPSGPDG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo