Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308021
StrainMtb_RGTB327
Protein IDYP_005360832.1
Description putative exported protease [Mycobacterium tuberculosis RGTB327]
Sequence MGMRLSRRDKIARMLLIWAALAAVALVLVGCIRVVGGRARMAEPKLGQPV
EWTPCRSSNPQVKIPGGALCGKLAVPVDYDRPDGDVAALALIRFPATGDK
IGSLVINPGGPGESGIEAALGVFQTLPKRVHERFDLVGFDPRGVASSRPA
IWCNSDADNDRLRAEPQVDYSREGVAHIENETKQFVGRCVDKMGKNFLAH
VGTVNVAKDLDAIRAALGDDKLTYLGYSYGTRIGSAYAEEFPQRVRAMIL
DGAVDPNADPIEAELRQAKGFQDAFNNYAADCAKNAGCPLGADPAKAVEV
YHSLVDPLVDPDNPRISRPARTKDPRGLSYSDAIVGTIMALYSPNLWQHL
TDGLSELVDNRGDTLLALADMYMRRDSHGRYNNSGDARVAINCVDQPPVT
DRDKVIDEDRRAREIAPFMSYGKFTGDAPLGTCAFWPVPPTSQPHAVSAP
GLVPTVVVSTTHDPATPYKAGVDLANQLRGSLLTFDGTQHTVVFQGDSCI
DEYVTAYLIGGTTPPSGAKC
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)53
MHC class II prediction (Propred)56
MHC class 1 prediction (Propred1)349
CTL epitope prediction (CTLpred)81
Prediction of interferon-gamma inducing peptides (IFNepitope)235
Prediction of IL4 inducing peptides (IL4pred)367