Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308054
StrainMtb_RGTB327
Protein IDYP_005360865.1
Description putative transcriptional regulator [Mycobacterium tuberculosis RGTB
Sequence MRLRPAEDSDDFLAWSSTDTTIDDAVHVTGPYDYLLHIRVCDTADLDRLL
RRLKTSAEAAQTQTRIALRSRR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo