Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308062
StrainMtb_RGTB327
Protein IDYP_005360873.1
Description short chain dehydrogenase [Mycobacterium tuberculosis RGTB327]
Sequence MAKDLVATVPDLSGKLAIITGANSGLGFGLARRLSAAGADVIMAIRNRAK
GEAAVEEIRTAVPDAKLTIKALDLSSLASVAALGEQLMADGRPIDLLINN
AGVMTPPERVTTADGFELQFGSNHLGHFALTAHLLPLLRAAQRARVVSLS
SLAARRGRIHFDDLQFERSYAPMTAYGQSKLAVLMFARELDRRSRAAGWG
IISNAAHPGLTKTNLQIAGPSHGRDKPALMERLYKTSWRFAPFLWQEIEE
GILPALYAAATPQADGGAFYGPRGRYEVAGGGVREAKVPAAARNDADSKR
LWEVSEQLTGVSYPKSR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo