Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308078
StrainMtb_RGTB327
Protein IDYP_005360889.1
Description putative phosphate-transport permease PitB [Mycobacterium tuberculo
Sequence MSDNAKHHRDGHLVASGLQDRAARTPQHEGFLGPDRPWHLSFSLLLAGSF
VLFSWWAFDYAGSGANKVILVLATVVGMFMAFNVGGNDVANSFGTSVGAG
TLTMKQALLVAAIFEVSGAVIAGGDVTETIRSGIVDLSGVSVDPRDFMNI
MLSALSAAALWLLFANRMGYPVSTTHSIIGGIVGAAIALGMVSGQGGAAL
RMVQWDQIGQIVVSWVLSPVLGGLVSYLLYGVIKRHILLYNEQAERRLTE
IKKERIAHRERHKAAFDRLTEIQQIAYTGALARDAVAANRKDFDPDELES
DYYRELHEIDAKTSSVDAFRALQNWVPLVAAAGSMIIVAMLLFKGFKHMH
LGLTTMNNYFIIAMVGAAVWMATFIFAKTLRGESLSRSTFLMFSWMQVFT
ASGFAFSHGSNDIANAIGPFAAILDVLRTGAIEGNAAVPAAAMVTFGVAL
CAGLWFIGRRVIATVGHNLTTMHPASGFAAELSAAGVVMGATVLGLPVSS
THILIGAVLGVGIVNRSTNWGLMKPIVLAWVITLPSAAILASVGLVALRA
IF
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo