Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308146
StrainMtb_RGTB327
Protein IDYP_005360957.1
Description putative transposase [Mycobacterium tuberculosis RGTB327]
Sequence MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETV
RKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASAFFA
AELDRPAR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo