Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308154
StrainMtb_RGTB327
Protein IDYP_005360965.1
Description DNA repair protein RecO [Mycobacterium tuberculosis RGTB327]
Sequence MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTRSKFGAR
LEPFAHIEVQLHPGRNLDIVTQVVSVDAFATDIVADYGRYTCGCAILETA
ERLAGEERAPAPALHRLTVGALRAVADGQRPRDLLLDAYLLRAMGIAGWA
PALTECARCATPGPHRAFHIATGGSVCAHCRPAGSTTPPLGVVDLMSALY
DGDWEAAEAAPQSARSHVSGLVAAHLQWHLERQLKTLPLVERFYQADRSV
AERRAALIGQDIAGG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo