Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308176
StrainMtb_RGTB327
Protein IDYP_005360987.1
Description putative ferredoxin-dependent nitrite reductase NIRA [Mycobacterium
Sequence MSAKENPQMTTARPAKARNEGQWALGHREPLNANEELKKAGNPLDVRERI
ENIYAKQGFDSIDKTDLRGRFRWWGLYTQREQGYDGTWTGDDNIDKLEAK
YFMMRVRCDGGALSAAALRTLGQISTEFARDTADISDRQNVQYHWIEVEN
VPEIWRRLDDVGLQTTEACGDCPRVVLGSPLAGESLDEVLDPTWAIEEIV
RRYIGKPDFADLPRKYKTAISGLQDVAHEINDVAFIGVNHPEHGPGLDLW
VGGGLSTNPMLAQRVGAWVPLGEVPEVWAAVTSVFRDYGYRRLRAKARLK
FLIKDWGIAKFREVLETEYLKRPLIDGPAPELVKHPIDHVGVQRLKNGLN
AVGVAPIAGRVSGTILTAVADLMARAGSDRIRFTPYQKLVILDIPDALLD
DLIAGLDALGLQSRPSHWRRNLMACSGIEFCKLSFAETRVRAQHLVPELE
RRLEDINSQLDVPITVNINGCPNSCARIQIADIGFKGQMIDDGHGGSVEG
FQVHLGGHLGLDAGFGRKLRQHKVTSDELGDYIDRVVRNFVKHRSEGERF
AQWVIRAEEDDLR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo