Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308228
StrainMtb_RGTB327
Protein IDYP_005361039.1
Description hypothetical protein MRGA327_15090 [Mycobacterium tuberculosis RGTB
Sequence MTDRSREPADPWKGFSAVMAATLILEAIVVLLAIPVVDAVGGGLRPASLG
YLVGLAVLLILLTGLQRRPWAIWVNLGAQPVLVTGFAVYPGVGFIGVLFA
ALWVLIAYLRAEVRRRRDYRVSQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo