Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308306
StrainMtb_RGTB327
Protein IDYP_005361117.1
Description putative amino acid decarboxylase [Mycobacterium tuberculosis RGTB3
Sequence MNPNSVRPRRLHVSALAAVANPSYTRLDTWNLLDDACRHLAEVDLAGLDT
THDVARAKRLMDRIGAYERYWLYPGAQNLATFRAHLDSHSTVRLTEEVSL
AVRLLSEYGDRTALFDTSASLAEQELVAQAKQQQFYTVLLADDSPATAPD
SLAECLRQLRNPADEVQFELLVVASIEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMTTLLGTDGDEAVANETHDWVECAEWIRELRPHIDLYLLTDE
SIAAETQDEPDVYDRTFYRLNDVTDLHSTVLAGLRNRYATPFFDALRAYA
AAPVGQFHALPVARGASIFNSKSLHDMGEFYGRNIFMAETSTTSGGLDSL
LDPHGNIKTAMDKAAVTWNANQTYFVTNGTSTANKIVVQALTRPGDIVLI
DRNCHKSHHYGLVLAGAYPMYLDAYPLPQYAIYGAVPLRTIKQALLDLEA
AGQLHRVRMLLLTNCTFDGVVYNPRRVMEEVLAIKPDICFLWDEAWYAFA
TAVPWARQRTAMIAAERLEQMLSTAEYAEEYRNWCASMDGVDRSEWVDHR
LLPDPNRARVRVYATHSTHKSLSALRQASMIHVRDQDFKALTRDAFGEAF
LTHTSTSPNQQLLASLDLARRQVDIEGFELVRHVYNMALVFRHRVRKDRL
ISKWFRILDESDLVPDAFRSSTVSSYRQVRQGALADWNEAWRSDQFVLDP
TRLTLFIGATGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVTWSS
VHYLLDVLRRVAIDLDRSQKAASGADLALHRRHVEEITQDLPHLPDFSEF
DLAFRPDDASSFGDMRSAFYAGYEEADREYVQIGLAGRRLAEGKTLVSTT
FVVPYPPGFPVLVPGQLVSKETIYFLAQLDVKEIHGYNPDLGLSVFTQAA
LARMEAARNAVATVGAALPAFEVPRDASALNGTVNGDSVLQGVAEDA
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)1
Vaccine TargetNo