Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308394
StrainMtb_RGTB327
Protein IDYP_005361205.1
Description hypothetical protein MRGA327_16175 [Mycobacterium tuberculosis RGTB
Sequence MSTQRPRHSGIRAVGPYAWAGRCGRIGRWGVHQEAMMNLAIWHPRKVQSA
TIYQVTDRSHDGRTARVPGDEITSTVSGWLSELGTQSPLADELARAVRIG
DWPAAYAIGEHLSVEIAVAV
B cell epitope (IEDB)0
T cell epitope (IEDB)11
MHC binder (IEDB)0
Vaccine TargetNo