Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308508
StrainMtb_RGTB327
Protein IDYP_005361319.1
Description putative CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltra
Sequence MSRSTRYSVAVSAQPETGQIAGRARIANLANILTLLRLVMVPVFLLALFY
GGGHHSAARVVAWAIFATACITDRFDGLLARNYGMATEFGAFVDPIADKT
LIGSALIGLSMLGDLPWWVTVLILTRELGVTVLRLAVIRRGVIPASWGGK
LKTFVQAVAIGLFVLPLSGPLHVAAVVVMAAAILLTVITGVDYVARALRD
IGGIRQTAS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo