Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308542
StrainMtb_RGTB327
Protein IDYP_005361353.1
Description 30S ribosomal protein S15 [Mycobacterium tuberculosis RGTB327]
Sequence MALTAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYISQIDVERYRSLIERLGLRR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo