Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308586
StrainMtb_RGTB327
Protein IDYP_005361397.1
Description sn-glycerol-3-phosphate-binding lipoprotein ugpB [Mycobacterium tub
Sequence MDPLNRRQFLALAAAAAGVTAGCAGMGGGGSVKSGSGPIDFWSSHPGQSS
AAERELIGRFQDRFPTLSVKLIDAGKDYDEVAQKFNAALIGTDVPDVVLL
DDRWWFHFALSGVLTALDDLFGQVGVDTTDYVDSLLADYEFNGRHYAVPY
ARSTPLFYYNKAAWQQAGLPDRGPQSWSEFDEWGPELQRVVGAGRSAHGW
ANADLISWTFQGPNWAFGGAYSDKWTLTLTEPATIAAGNFYRNSIHGKGY
AAVANDIANEFATGILASAVASTGSLAGITASARFDFGAAPLPTGPDAAP
ACPTGGAGLAIPAKLSEERKVNALKFIAFVTNPTNTAYFSQQTGYLPVRK
SAVDDASERHYLADNPRARVALDQLPHTRTQDYARVFLPGGDRIISAGLE
SIGLRGADVTKTFTNIQKRLQVILDRQIMRKLAGHG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo