Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308598
StrainMtb_RGTB327
Protein IDYP_005361409.1
Description putative multifunctional enzyme siroheme synthase CYSG: uroporphyri
Sequence MTENPYLVGLRLAGKKVVVVGGGTVAQRRLPLLIASGADVHVIAPSVTPA
VEAMDQITLSVRDYRDGDLDGAWYAIAATDDARVNVAVVAEAERRRIFCV
RADIAVEGTAVTPASFSYAGLSVGVLAGGEHRRSAAIRSAIREALQQGVI
TAQSSDVLSGGVALVGGGPGDPELITVRGRRLLAQADVVVADRLAPPELL
AELPPHVEVIDAAKIPYGRAMAQDAINAVLIERARSGNFVVRLKGGDPFV
FARGYEEVLACAHAGIPVTVVPGVTSAIAVPAMAGVPVTHRAMTHEFVVV
SGHLAPGHPESLVNWDALAALTGTIVLLMAVERIELFVDVLLKGGRTADT
PVLVVQHGTTAAQQTLRATLADTPEKVRAAGIRPPAIIVIGAVVGLSGVR
GLNNS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo