Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308620
StrainMtb_RGTB327
Protein IDYP_005361431.1
Description hypothetical protein MRGA327_17590 [Mycobacterium tuberculosis RGTB
Sequence MMFVTGIVLFALAILISVALHECGHMWVARRTGMKVRRYFVGFGPTLWST
RRGETEYGVKAVPLGGFCDIAGMTPVEELDPDERDRAMYKQATWKRVAVL
FAGPGMNLAICLVLIYAIALVWGLPNLHPPTRAVIGETGCVAQEVSQGKL
EQCTGPGPAALAGIRSGDVVVKVGDTPVSSFDEMAAAVRKSHGSVPIVVE
RDGTAIVTYVDIESTQRWIPNGQGGELQPATVGAIGVGAARVGPVRYGVF
SAMPATFAVTGDLTVEVGKALAALPTKVGALVRAIGGGQRDPQTPISVVG
ASIIGGDTVDHGLWVAFWFFLAQLNLILAAINLLPLLPFDGGHIAVAVFE
RIRNMVRSARGKVAAAPVNYLKLLPATYVVLVLVVGYMLLTVTADLVNPI
RLFQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)24
MHC class II prediction (Propred)87
MHC class 1 prediction (Propred1)288
CTL epitope prediction (CTLpred)86
Prediction of interferon-gamma inducing peptides (IFNepitope)153
Prediction of IL4 inducing peptides (IL4pred)258