Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308624
StrainMtb_RGTB327
Protein IDYP_005361435.1
Description cell surface lipoprotein Mpt83 [Mycobacterium tuberculosis RGTB327]
Sequence MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTA
AMADPAADLIGRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLT
SALSGKLNPDVNLVDTLNGGEYTVFAPTNAAFDKLPAATIDQLKTDAKLL
SSILTYHVIAGQASPSRIDGTHQTLQGADLTVIGARDDLMVNNAGLVCGG
VHTANATVYMIDTVLMPPAQ
B cell epitope (IEDB)7
T cell epitope (IEDB)28
MHC binder (IEDB)0
Vaccine TargetNo